missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC37A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £443.00
Specifications
| Antigen | SLC37A4 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18479591
|
Novus Biologicals
NBP2-31973-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18151164
|
Novus Biologicals
NBP2-31973 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC37A4 Polyclonal specifically detects SLC37A4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC37A4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19 | |
| SLC37A4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| None | |
| 2542 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NEPADVGLRNLDPMPSEGKKGSLKEESTLQE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title