missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18384168

SLC37A4 Antibody (7B9), Novus Biologicals™

Product Code. 18384168 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18384168 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18384168 Supplier Novus Biologicals Supplier No. H00002542M01100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SLC37A4 Monoclonal antibody specifically detects SLC37A4 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC37A4
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 7B9
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001458.1
Gene Alias G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Host Species Mouse
Immunogen SLC37A4 (NP_001458.1, 28 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2542
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.