SLC35B2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18467910	Novus Biologicals NBP1-80641-25ul	25ul
18288766	Novus Biologicals NBP1-80641	0.1 mL

Description

SLC35B2 Polyclonal specifically detects SLC35B2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC35B2
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 347734
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, PAPST13'-phosphoadenosine 5'-phosphosulfate transporter, Putative MAPK-activating protein PM15, Putative NF-kappa-B-activating protein 48, SLL, Solute carrier family 35 member B2, solute carrier family 35 member B2 variant 2, solute carrier family 35, member B2, UGTrel4
• Gene Symbols: SLC35B2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only