missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC35A5 Polyclonal specifically detects SLC35A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
Spécification
| Antigen | SLC35A5 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | DKFZp434E102, FLJ11130, FLJ20730, FLJ25973, probable UDP-sugar transporter protein SLC35A5, Solute carrier family 35 member A5, solute carrier family 35, member A5 |
| Gene Symbols | SLC35A5 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TLQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARV |
| Afficher plus |
For Research Use Only
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?