missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC34A1 Polyclonal specifically detects SLC34A1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | SLC34A1 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, NaPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1 |
| Gene Symbols | SLC34A1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA |
| Show More |
For Research Use Only
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?