missing translation for 'onlineSavingsMsg'
Learn More

SLC29A4 Antibody (6B6), Novus Biologicals™

Product Code. 18419509 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18419509 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18419509 Supplier Novus Biologicals Supplier No. H00222962M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SLC29A4 Monoclonal antibody specifically detects SLC29A4 in Human, Rat samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC29A4
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 6B6
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_694979
Gene Alias ENT4PMAT, equilibrative nucleoside transporter 4, FLJ34923, hENT4, Plasma membrane monoamine transporter, solute carrier family 29 (nucleoside transporters), member 4, Solute carrier family 29 member 4
Host Species Mouse
Immunogen SLC29A4 (NP_694979, 283 a.a. ∽ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 222962
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.