missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18327488

SLC28A2 Antibody (2D3), Novus Biologicals™

Product Code. 18327488 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327488 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327488 Supplier Novus Biologicals Supplier No. H00009153M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SLC28A2 Monoclonal antibody specifically detects SLC28A2 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC28A2
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2D3
Conjugate Unconjugated
Dilution Western Blot, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004203
Gene Alias CNT2SPNT, Concentrative nucleoside transporter 2, FLJ21468, HCNT2, HsT17153, MGC138252, Na(+)/nucleoside cotransporter 2, sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Sodium-coupled nucleoside transporter 2, solute carrier family 28 (sodium-coupled nucleoside transporter), member 2, Solute carrier family 28 member 2, SPNT1CNT 2
Host Species Mouse
Immunogen SLC28A2 (NP_004203.1, 1 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHARLFKK
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9153
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.