SLC26A11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18405431	Novus Biologicals NBP1-86346-25ul	25 μL
18252568	Novus Biologicals NBP1-86346	0.1 mL

Description

SLC26A11 Polyclonal specifically detects SLC26A11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Spécification

• Antigen: SLC26A11
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: MGC46523, sodium-independent sulfate anion transporter, Solute carrier family 26 member 11, solute carrier family 26, member 11
• Gene Symbols: SLC26A11
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 284129
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only