SLC25A46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59604

Product Code. 18258432

Description

SLC25A46 Polyclonal specifically detects SLC25A46 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC25A46
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: solute carrier family 25 member 46, solute carrier family 25, member 46, TB1
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96AG3
• Gene Symbols: SLC25A46
• Immunogen: Synthetic peptides corresponding to SLC25A46(solute carrier family 25, member 46) The peptide sequence was selected from the C terminal of SLC25A46. Peptide sequence LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91137
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only