missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A35 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SLC25A35 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin |
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18441042
|
Novus Biologicals
NBP2-13324-25ul |
25ul |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18012299
|
Novus Biologicals
NBP2-13324 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivning
SLC25A35 Polyclonal specifically detects SLC25A35 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| SLC25A35 | |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 399512 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: IYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ40217, MGC120446, MGC120448, solute carrier family 25 member 35, solute carrier family 25, member 35 | |
| SLC25A35 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel