SLC25A23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18462262	Novus Biologicals NBP2-13321-25ul	25ul
18004329	Novus Biologicals NBP2-13321	0.1 mL

Description

SLC25A23 Polyclonal specifically detects SLC25A23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC25A23
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 79085
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: APC2FLJ30339, calcium-binding mitochondrial carrier protein SCaMC-3, MCSC2, MGC2615, Mitochondrial ATP-Mg/Pi carrier protein 2, Mitochondrial Ca(2+)-dependent solute carrier protein 2, mitochondrial Ca2+-dependent solute carrier protein 2, SCaMC-3, SCAMC3, short calcium-binding mitochondrial carrier 3, Small calcium-binding mitochondrial carrier protein 3, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23, Solute carrier family 25 member 23
• Gene Symbols: SLC25A23
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only