missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A19 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94007-0.02ml
This item is not returnable.
View return policy
Description
SLC25A19 Polyclonal antibody specifically detects SLC25A19 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| SLC25A19 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| DNC, MCPHA, mitochondrial thiamine pyrophosphate carrier, mitochondrial uncoupling protein 1, MUP1, solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19, solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19, TPC | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human SLC25A19 (NP_068380.3). MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWK | |
| 0.02 mL | |
| Primary | |
| Human, Mouse | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 60386 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction