missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC24A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05674-20ul
This item is not returnable.
View return policy
Description
SLC24A2 Polyclonal antibody specifically detects SLC24A2 in Human, Mouse samples. It is validated for Western Blot
Specifications
| SLC24A2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| retinal cone Na-Ca+K exchanger, solute carrier family 24 (sodium/potassium/calcium exchanger), member 2 | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human SLC24A2 (NP_001180217.1). VKVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLAEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNS | |
| 20 μg | |
| Growth and Development, Neuronal Cell Markers | |
| 25769 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction