missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC22A2/OCT2 Antibody, Novus Biologicals™

SLC22A2/OCT2 Antibody, Novus Biologicals™

Product Code. 18430841 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18430841 25 μL 25µL
18711214 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18430841 Supplier Novus Biologicals Supplier No. NBP18941725ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 2 publications

SLC22A2/OCT2 Polyclonal specifically detects SLC22A2/OCT2 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Single Cell Western.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC22A2/OCT2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Western Blot Reactivity reported in scientific literature (PMID: 26045896)., Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Single Cell Western Single Cell Western reported by an internal validation at a 1:20 dilution
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O15244
Gene Alias hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2
Gene Symbols SLC22A2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR
Molecular Weight of Antigen 63 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6582
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.