missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SLC22A15 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLC22A15 Polyclonal specifically detects SLC22A15 in Human samples. It is validated for Western Blot.Specifications
| SLC22A15 | |
| Polyclonal | |
| Rabbit | |
| DKFZp761G0313, Flipt 1, FLIPT1PRO34686, fly-like putative organic ion transporter 1, Fly-like putative transporter 1, solute carrier family 22 (organic cation transporter), member 15, solute carrier family 22 member 15, solute carrier family 22, member 15, trans-like protein | |
| SLC22A15 | |
| IgG | |
| 59 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 55356 | |
| Synthetic peptides corresponding to SLC22A15(solute carrier family 22, member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title