missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18421169

SLC22A12 Antibody (2B5), Novus Biologicals™

Product Code. 18421169 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18421169 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18421169 Supplier Novus Biologicals Supplier No. H00116085M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SLC22A12 Monoclonal antibody specifically detects SLC22A12 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC22A12
Applications Western Blot, ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 2B5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_653186
Gene Alias OATL4, Organic anion transporter 4-like protein, Renal-specific transporter, RSTmember 12, solute carrier family 22 (organic anion/urate transporter), member 12, URAT1, URAT1Urate anion exchanger 1, urate transporter 1
Host Species Mouse
Immunogen SLC22A12 (NP_653186.2, 281 a.a. ∽ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 116085
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.