missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A11 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94224-0.02ml
This item is not returnable.
View return policy
Description
SLC22A11 Polyclonal antibody specifically detects SLC22A11 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SLC22A11 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| hOAT4, MGC34282, OAT4solute carrier family 22 (organic anion/cation transporter), member 11, Organic anion transporter 4, solute carrier family 22 (organic anion/urate transporter), member 11, solute carrier family 22 member 11 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human SLC22A11 (NP_060954.1). FSAAIPGHRCWTHMLDNGSAVSTNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 55867 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction