missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC20A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | SLC20A1 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18600386
|
Novus Biologicals
NBP2-38266-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18120368
|
Novus Biologicals
NBP2-38266 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC20A1 Polyclonal specifically detects SLC20A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC20A1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ41426, Gibbon ape leukemia virus receptor 1, Glvr-1, GLVR1DKFZp686J2397, Leukemia virus receptor 1 homolog, Phosphate transporter 1, PiT-1PIT1, sodium-dependent phosphate transporter 1, solute carrier family 20 (phosphate transporter), member 1, Solute carrier family 20 member 1 | |
| SLC20A1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8WUM9 | |
| 6574 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title