missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC1A4 Polyclonal specifically detects SLC1A4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones
Especificaciones
| Antigen | SLC1A4 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide |
| Gene Alias | Alanine/serine/cysteine/threonine transporter 1, ASCT1, ASCT1 ASCT-1, neutral amino acid transporter A, SATTglutamate/neutral amino acid transporter, solute carrier family 1 (glutamate/neutral amino acid transporter), member 4, Solute carrier family 1 member 4 |
| Gene Symbols | SLC1A4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA |
| Mostrar más |
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?