missing translation for 'onlineSavingsMsg'
Learn More

SLC19A3 Antibody (3B2), Novus Biologicals™

Product Code. 18416089 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18416089 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18416089 Supplier Novus Biologicals Supplier No. H00080704M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SLC19A3 Monoclonal antibody specifically detects SLC19A3 in Human samples. It is validated for ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC19A3
Applications ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3B2
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_079519
Gene Alias Solute carrier family 19 member 3, solute carrier family 19, member 3, thiamine transporter 2, ThTr2, ThTr-2
Host Species Mouse
Immunogen SLC19A3 (NP_079519.1, 191 a.a. ∽ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKR
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80704
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.