missing translation for 'onlineSavingsMsg'
Learn More

SLC15A3 Antibody (5B4), Novus Biologicals™

Product Code. 18359759 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359759 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359759 Supplier Novus Biologicals Supplier No. H00051296M04100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SLC15A3 Monoclonal antibody specifically detects SLC15A3 in Human, Rat samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC15A3
Applications Western Blot, ELISA
Classification Monoclonal
Clone 5B4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057666.1
Gene Alias FLJ26631, hPTR3, OCTP, Osteoclast transporter, Peptide transporter 3, Peptide/histidine transporter 2, PHT2PTR3, solute carrier family 15 member 3, solute carrier family 15, member 3
Host Species Mouse
Immunogen SLC15A3 (NP_057666.1, 254 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPPMGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQ
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51296
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.