missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC13A4 Antibody - Azide and BSA Free, Novus Biologicals™

SLC13A4 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18664142 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18664142 0.02 mL 0.02mL
18626102 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18664142 Supplier Novus Biologicals Supplier No. NBP2948530.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SLC13A4 Polyclonal antibody specifically detects SLC13A4 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC13A4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias Na(+)/sulfate cotransporter SUT-1, NaS2, solute carrier family 13 (sodium/sulfate symporters), member 4, solute carrier family 13 (sodium/sulphate symporters), member 4, sulphate transporter 1, SUT-1, SUT1solute carrier family 13 member 4
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 390-465 of human SLC13A4 (NP_036582.2). WFTREPGFVPGWDSFFEKKGYRTDATVSVFLGFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWE
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26266
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.