SLC13A3/NaDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-82603-25ul

Product Code. 18493371

Description

SLC13A3/NaDC3 Polyclonal antibody specifically detects SLC13A3/NaDC3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SLC13A3/NaDC3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: hNaDC3, Na(+)/dicarboxylate cotransporter 3, NaDC-3, NADC3SDCT2naDC-3, sodium-dependent high affinity dicarboxylate transporter 3, Sodium-dependent high-affinity dicarboxylate transporter 2, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, solute carrier family 13 member 3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64849
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG