missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC13A3/NaDC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82603
This item is not returnable.
View return policy
Description
SLC13A3/NaDC3 Polyclonal antibody specifically detects SLC13A3/NaDC3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLC13A3/NaDC3 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| hNaDC3, Na(+)/dicarboxylate cotransporter 3, NaDC-3, NADC3SDCT2naDC-3, sodium-dependent high affinity dicarboxylate transporter 3, Sodium-dependent high-affinity dicarboxylate transporter 2, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, solute carrier family 13 member 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 64849 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction