SLC13A3/NaDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69630

Product Code. 18270965

Description

SLC13A3/NaDC3 Polyclonal specifically detects SLC13A3/NaDC3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC13A3/NaDC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hNaDC3, Na(+)/dicarboxylate cotransporter 3, NaDC-3, NADC3SDCT2naDC-3, sodium-dependent high affinity dicarboxylate transporter 3, Sodium-dependent high-affinity dicarboxylate transporter 2, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3, solute carrier family 13 member 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 67 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WWT9
• Gene Symbols: SLC13A3
• Immunogen: Synthetic peptides corresponding to SLC13A3(solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3) The peptide sequence was selected from the N terminal of SLC13A3 (NP_073740). Peptide sequence MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64849
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only