missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC10A7 Polyclonal specifically detects SLC10A7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | SLC10A7 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | C4orf13, chromosome 4 open reading frame 13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043, Na(+)/bile acid cotransporter 7, P7, SBF-domain containing protein, sodium/bile acid cotransporter 7, solute carrier family 10 (sodium/bile acid cotransporter family), member 7, Solute carrier family 10 member 7 |
| Gene Symbols | SLC10A7 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSITPINEWLLKGLQTVGCMPPPVSSAVILTKAVGGNEAAAIFNSAFGSFLVSKHSLTCLLQL |
| Afficher plus |
For Research Use Only
Nom du produit
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?