SLC10A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals NBP1-88813

Artikelnummer. 18254476

Beschreibung

SLC10A2 Polyclonal specifically detects SLC10A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: SLC10A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: Apical sodium-dependent bile acid transporter, ASBT, IBAT, ileal apical sodium-dependent bile acid transporter, Ileal Na(+)/bile acid cotransporter, ileal sodium/bile acid cotransporter, Ileal sodium-dependent bile acid transporter, ISBT, Na(+)-dependent ileal bile acid transporter, NTCP2PBAM, Sodium/taurocholate cotransporting polypeptide, ileal, solute carrier family 10 (sodium/bile acid cotransporter family), member 2, Solute carrier family 10 member 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6555
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC10A2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NKAEIPESKENGTEPESSFYKANGGFQPDE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only