missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC10A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93416-0.02ml
This item is not returnable.
View return policy
Description
SLC10A2 Polyclonal antibody specifically detects SLC10A2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SLC10A2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Apical sodium-dependent bile acid transporter, ASBT, IBAT, ileal apical sodium-dependent bile acid transporter, Ileal Na(+)/bile acid cotransporter, ileal sodium/bile acid cotransporter, Ileal sodium-dependent bile acid transporter, ISBT, Na(+)-dependent ileal bile acid transporter, NTCP2PBAM, Sodium/taurocholate cotransporting polypeptide, ileal, solute carrier family 10 (sodium/bile acid cotransporter family), member 2, Solute carrier family 10 member 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1). FPLIYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6555 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction