missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLAM/CD150 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | SLAM/CD150 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18609506
|
Novus Biologicals
NBP2-62662-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625227
|
Novus Biologicals
NBP2-62662 |
100 μg |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLAM/CD150 Polyclonal antibody specifically detects SLAM/CD150 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SLAM/CD150 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Hematopoietic Stem Cell Markers, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 6504 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD 150, CD150IPO-3, CDw150, signaling lymphocytic activation molecule, signaling lymphocytic activation molecule family member 1, SLAMCD150 antigen | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title