Skp2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49142

Product Code. 18645448

Description

Skp2 Polyclonal antibody specifically detects Skp2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown

Specifications

• Antigen: Skp2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
• Gene Alias: CDK2/cyclin A-associated protein p45, cyclin A/CDK2-associated protein p45, Cyclin-A/CDK2-associated protein p45, FBL1, F-box protein Skp2, F-box/LRR-repeat protein 1, FBXL1MGC1366, FLB1, p45skp2, S-phase kinase-associated protein 2, S-phase kinase-associated protein 2 (p45)
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLS
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6502
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified