Skp1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18262465	Novus Biologicals NBP2-58725	100 μL
18608196	Novus Biologicals NBP2-58725-25ul	25 μL

Description

Skp1 Polyclonal specifically detects Skp1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Skp1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Wnt Signaling Pathway
• Gene Alias: Cyclin-A/CDK2-associated protein p19, EMC19p19skp1, MGC34403, OCP2OCP-2, OCP-IIS-phase kinase-associated protein 1A (p19A), Organ of Corti protein 2, Organ of Corti protein II, p19Acyclin A/CDK2-associated p19, RNA polymerase II elongation factor-like protein, RNA polymerase II elongation factor-like protein OCP2, SKP1Acyclin A/CDK2-associated protein p19, S-phase kinase-associated protein 1, TCEB1LSIII, Transcription elongation factor B
• Gene Symbols: SKP1
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene ID (Entrez): 6500
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKE
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only