missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SKIV2L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | SKIV2L |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18330797
|
Novus Biologicals
NBP3-17769-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18332235
|
Novus Biologicals
NBP3-17769-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SKIV2L Polyclonal antibody specifically detects SKIV2L in Human samples. It is validated for ImmunofluorescenceSpecifications
| SKIV2L | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism, Unfolded Protein Response, Vision | |
| PBS, pH 7.2, 40% glycerol | |
| 6499 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 170A, DDX13helicase SKI2W, EC 3.6.1, Helicase-like protein, HLPEC 3.6.4.-, SKI2, SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like, SKIV2, superkiller viralicidic activity 2-like (S. cerevisiae), W | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title