missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SKIV2L Rabbit anti-Human, Polyclonal, Novus Biologicals™

SKIV2L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18332235 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18332235 100 μg 100µL
18330797 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18332235 Leverantör Novus Biologicals Leverantörsnummer NBP317769100UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

SKIV2L Polyclonal antibody specifically detects SKIV2L in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen SKIV2L
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 170A, DDX13helicase SKI2W, EC 3.6.1, Helicase-like protein, HLPEC 3.6.4.-, SKI2, SKI2Wsuperkiller viralicidic activity 2 (S. cerevisiae homolog)-like, SKIV2, superkiller viralicidic activity 2-like (S. cerevisiae), W
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: TGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Unfolded Protein Response, Vision
Primary or Secondary Primary
Gene ID (Entrez) 6499
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.