missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SKAP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
£193.00 - £474.00
Specifications
| Antigen | SKAP |
|---|---|
| Dilution | Simple Western 1:20, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18432151
|
Novus Biologicals
NBP1-94007-25ul |
25 μL |
£193.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18063477
|
Novus Biologicals
NBP1-94007 |
0.1 mL |
£474.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SKAP Polyclonal specifically detects SKAP in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SKAP | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 90417 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Simple Western 1:20, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C15orf23, chromosome 15 open reading frame 23, FLJ14502, HSD11, MGC141728, MGC141729, putative TRAF4-associated factor 1, SKAP, small kinetochore associated protein, TRAF4 associated factor 1, TRAF4AF1 | |
| KNSTRN | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title