missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SKA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SKA3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SKA3 Polyclonal specifically detects SKA3 in Human samples. It is validated for Western Blot.Specifications
| SKA3 | |
| Polyclonal | |
| Rabbit | |
| spindle and kinetochore associated complex subunit 3, spindle and kinetochore-associated protein 3 | |
| SKA3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 221150 | |
| Synthetic peptides corresponding to SKA3 (spindle and kinetochore associated complex subunit 3) The peptide sequence was selected from the middle region of SKA3. Peptide sequence EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title