SIT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18404202	Novus Biologicals NBP2-13311-25ul	25ul
18133540	Novus Biologicals NBP2-13311	0.1 mL

Description

SIT1 Polyclonal specifically detects SIT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SIT1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: gp30/40, MGC125908, MGC125909, RP11-331F9.5, SHP2 interacting transmembrane adaptor, SHP2-interacting transmembrane adapter protein, SHP2-interacting transmembrane adaptor protein, signaling threshold regulating transmembrane adaptor 1, signaling threshold-regulating transmembrane adapter 1, SITMGC125910, suppression inducing transmembrane adaptor 1, Suppression-inducing transmembrane adapter 1
• Gene Symbols: SIT1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 27240
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only