missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Sirtuin 5/SIRT5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-89535
This item is not returnable.
View return policy
Description
Sirtuin 5/SIRT5 Polyclonal antibody specifically detects Sirtuin 5/SIRT5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Sirtuin 5/SIRT5 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| EC 3.5.1, EC 3.5.1.-, FLJ36950, NAD-dependent deacetylase sirtuin-5, silent mating type information regulation 2, S.cerevisiae, homolog 5, SIR2L5, sir2-like 5, SIR2-like protein 5, sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 5, sirtuin 5, sirtuin type 5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVW | |
| 0.1 mL | |
| Epigenetics | |
| 23408 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction