missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIRT4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38446-20ul
This item is not returnable.
View return policy
Description
SIRT4 Polyclonal antibody specifically detects SIRT4 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| SIRT4 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| EC 2.4.2.-, EC 3.5.1, MGC130046, MGC130047, MGC57437, SIR2L4NAD-dependent ADP-ribosyltransferase sirtuin-4, sir2-like 4, SIR2-like protein 4, sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4, sirtuin 4, sirtuin type 4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 29-313 of human SIRT4 (NP_036372.1).,, Sequence:, IGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQ | |
| 20 μL | |
| DNA Repair, Epigenetics, Homologous Recombination | |
| 23409 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction