missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SIRPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

SIRPB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18331697 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Packungsgröße:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18331697 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18331697 Lieferant Novus Biologicals Lieferanten-Nr. NBP309533100UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

SIRPB2 Polyclonal specifically detects SIRPB2 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen SIRPB2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias dJ776F14.2, Protein Tyrosine Phosphatase Non-Receptor Type Substrate 1-Like 3, Protein Tyrosine Phosphatase Non-Receptor Type Substrate Protein, Protein Tyrosine Phosphatase, Non-Receptor Type 1-Like, Protein Tyrosine Phosphatase, Non-Receptor Type Substrate 1-Like 3, PTPN1L, PTPNS1L3, Signal-Regulatory Protein Beta 2, Signal-Regulatory Protein Beta-2, SIRP-beta-2, SIRPG
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIRPB2 (NP_001128308). Peptide sequence VSSEDAGTYYCVKFQRKPNRQYLSGQGTSLKVKAKSTSSKEAEFTSEPAT
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 284759
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.