missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SIN3B Polyclonal antibody specifically detects SIN3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | SIN3B |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot -Reported in scientific literature (PMID: 28857552), Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | Histone deacetylase complex subunit Sin3b, KIAA0700paired amphipathic helix protein Sin3b, SIN3 homolog B, transcription regulator (yeast), SIN3 homolog B, transcriptional regulator, SIN3 homolog B, transcriptional regulator (yeast), Transcriptional corepressor Sin3b |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: LISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPP |
| Purification Method | Immunogen affinity purified |
| Show More |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?