missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SIN3B Monoclonal antibody specifically detects SIN3B in Human samples. It is validated for ELISA, ELISA
Specifications
Specifications
| Antigen | SIN3B |
| Applications | ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2C11 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_056075 |
| Gene Alias | Histone deacetylase complex subunit Sin3b, KIAA0700paired amphipathic helix protein Sin3b, SIN3 homolog B, transcription regulator (yeast), SIN3 homolog B, transcriptional regulator, SIN3 homolog B, transcriptional regulator (yeast), Transcriptional corepressor Sin3b |
| Host Species | Mouse |
| Immunogen | SIN3B (NP_056075.1, 1063 a.a. ~ 1160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPA |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?