missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SIK1/Snf1lk Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35517-100ul
This item is not returnable.
View return policy
Description
SIK1/Snf1lk Polyclonal antibody specifically detects SIK1/Snf1lk in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| SIK1/Snf1lk | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| EC 2.7.11, EC 2.7.11.1, msk, myocardial SNF1-like kinase, salt-inducible kinase 1, Salt-inducible protein kinase 1, serine/threonine protein kinase, serine/threonine-protein kinase SIK1, Serine/threonine-protein kinase SNF1-like kinase 1, Serine/threonine-protein kinase SNF1LK, SIK, SIK-1, SNF1-like kinase, SNF1LKMSK | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIK1/Snf1lk (NP_775490.2).,, Sequence:, MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLY | |
| 100 μL | |
| Protein Kinase | |
| 150094 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction