Signal Peptide Peptidase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-74111

Product Code. 18293102

Description

Signal Peptide Peptidase Polyclonal specifically detects Signal Peptide Peptidase in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Signal Peptide Peptidase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ324O17.1, EC 3.4.23.-, H13hIMP1, histocompatibility (minor) 13, IMP-1, IMP1MSTP086, Intramembrane protease 1, minor histocompatibility antigen 13, minor histocompatibility antigen H13, Presenilin-like protein 3, PSENL3, PSL3IMPAS, Signal peptide peptidase, signal peptide peptidase beta, SPPIMPAS-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81502
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9D8V0
• Gene Symbols: HM13
• Immunogen: Synthetic peptides corresponding to the middle region of H13. Immunizing peptide sequence IKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG