missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Siglec-6/CD327 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21226-25ul
This item is not returnable.
View return policy
Description
Siglec-6/CD327 Polyclonal antibody specifically detects Siglec-6/CD327 in Human samples. It is validated for Immunofluorescence
Specifications
| Siglec-6/CD327 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CD327 antigen, CD33 antigen-like 1, CD33L1OBBP1CD327, CD33L2, CD33LCDW327, CDw327, OB-BP1, Obesity-binding protein 1, sialic acid binding Ig-like lectin 6, sialic acid-binding Ig-like lectin 6, Siglec-6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK | |
| 25 μg | |
| Immunology | |
| 946 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction