Siglec-1/CD169 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP2-30903-25ul

Product Code. 18490332

Description

Siglec-1/CD169 Polyclonal specifically detects Siglec-1/CD169 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Dual RNAscope ISH-IHC.

Specifications

• Antigen: Siglec-1/CD169
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500, Dual RNAscope ISH-IHC
• Gene Accession No.: Q9BZZ2
• Gene Symbols: SIGLEC1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
• Quantity: 25 μL
• Research Discipline: Adaptive Immunity, Immunology
• Gene ID (Entrez): 6614
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), In Situ Hybridization (ISH)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CD169, FLJ00051, sialic acid binding Ig-like lectin 1, sialoadhesin, sialoadhesin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only