missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Shugoshin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | Shugoshin |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18365894
|
Novus Biologicals
NBP3-17932-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18322036
|
Novus Biologicals
NBP3-17932-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Shugoshin Polyclonal antibody specifically detects Shugoshin in Human samples. It is validated for Western BlotSpecifications
| Shugoshin | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer | |
| PBS, pH 7.2, 40% glycerol | |
| 151648 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ14230, hSgo1, NY-BR-85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein, shugoshin-like 1, shugoshin-like 1 (S. pombe) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title