missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Shugoshin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Shugoshin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18322036 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Packungsgröße:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18322036 100 μg 100µL
18365894 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18322036 Lieferant Novus Biologicals Lieferanten-Nr. NBP317932100UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Shugoshin Polyclonal antibody specifically detects Shugoshin in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Shugoshin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias FLJ14230, hSgo1, NY-BR-85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1, shugoshin 1AB protein, shugoshin 1CD protein, shugoshin 1EF protein, shugoshin 1GH protein, shugoshin 1KL protein, shugoshin-like 1, shugoshin-like 1 (S. pombe)
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKSTDNVLPRTVSVRSSLKKHCNSICQF
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 151648
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.