Shrew-1/AJAP1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque:  Novus Biologicals NBP2-93906-0.02ml

Code produit. 18658211

Description

Shrew-1/AJAP1 Polyclonal antibody specifically detects Shrew-1/AJAP1 in Human, Mouse, Rat samples. It is validated for Western Blot

Spécification

• Antigen: Shrew-1/AJAP1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: adherens junction associated protein 1, adherens junction-associated protein 1, adherens junctions associated protein 1, membrane protein shrew-1, MOT8, RP3-426F10.1, SHREW1, SHREW-1, transmembrane protein SHREW1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Shrew-1/AJAP1 (NP_061324.1). TLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVA
• Quantity: 0.02 mL
• Research Discipline: Cancer, Cell Biology, Cytoskeleton Markers, Signal Transduction
• Gene ID (Entrez): 55966
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified