Invitrogen™ SHP2 Monoclonal Antibody (2E6)

Mouse Monoclonal Antibody

Brand:  Invitrogen™ MA549146

Product Code. 17961501

Description

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence identical to the related mouse and rat sequences. Positive Control - WB: human HepG2 whole cell, human Jurkat whole cell, human CCRF-CEM whole cellhuman K562 whole cell, human A549 whole cell, human CACO-2 whole cell, human Hela whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, mouse Neuro-2a whole cell. IHC: human colon cancer tissue, human tonsil tissue, mouse brain tissue, rat brain tissue. ICC/IF: U251 cell. Flow: A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Specifications

• Antigen: SHP2
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P35235, P41499, Q06124
• Gene Symbols: PTPN11
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 2E6
• Conjugate: Unconjugated
• Gene: PTPN11
• Gene Alias: 2700084A17Rik; AW536184; bptp3; CFC; cSH-PTP2; encodes catalytic domain; HCP; HGNC:9644; JMML; METCDS; MGC14433; Noonan syndrome 1; ns1; null; OTTHUMP00000166108; phosphotyrosyl-protein phosphatase; protein tyrosine phosphatase non-receptor type 11; protein tyrosine phosphatase SH-PTP2; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase, non-receptor type 11 (Noonan syndrome 1); protein tyrosine phosphatase, non-receptor type 11 S homeolog; protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; protein-tyrosine phosphatase SYP; PTP1C; PTP1D; PTP-1D; ptp-2; PTP2C; PTP-2C; Ptpn11; ptpn11.S; ptpn11-a; ptpn11-b; SAP-2; SH2 domain-containing protein tyrosine phosphatase-2; Shp2; shp-2; SHPTP2; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; Syp; Tyrosine-protein phosphatase non-receptor type 11; XELAEV_18010676mg
• Host Species: Mouse
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 19247, 25622, 5781
• Content And Storage: -20°C
• Form: Lyophilized