missing translation for 'onlineSavingsMsg'
Learn More

SHOX2 Antibody (1D1), Novus Biologicals™

Product Code. 18420100 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18420100 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18420100 Supplier Novus Biologicals Supplier No. H00006474M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SHOX2 Monoclonal antibody specifically detects SHOX2 in Human, Rat samples. It is validated for Western Blot, ELISA, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen SHOX2
Applications Western Blot, ELISA, Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 1D1
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006875
Gene Alias Homeobox protein Og12X, OG12SHOX homologous gene on chromosome 3, OG12Xshort stature homeobox protein 2, short stature homeobox 2, SHOTPaired-related homeobox protein SHOT
Host Species Mouse
Immunogen SHOX2 (NP_006875, 117 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6474
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.